PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004510581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 191aa    MW: 22113.1 Da    PI: 8.4476
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004510581.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.43.2e-172167147
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    k+ie + + qv+fskR+ g++ K  ELS+LC+a+ a+ii s++ kly
  XP_004510581.1 21 KKIEQSNKLQVSFSKRKLGLFNKVTELSILCQAKTAMIITSPNEKLY 67
                    6899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.7921373IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-201372IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-201483IPR002100Transcription factor, MADS-box
CDDcd001202.19E-191567No hitNo description
PRINTSPR004041.6E-131535IPR002100Transcription factor, MADS-box
PfamPF003193.5E-172267IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-133550IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-135071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MVSSNGNNTS TKSSKRKIDI KKIEQSNKLQ VSFSKRKLGL FNKVTELSIL CQAKTAMIIT  60
SPNEKLYACG YPNPDSVINQ FITQENNVVI DNEKKKQDEE IFETLRFQYE ELQEKLKEET  120
NNLLKERNKG DACSTSWWDR SIDDMSVESL EQFKNSLENL KLNIVTALEE KRVNSIYSTQ  180
PHQERIKLLK S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004510581.11e-137PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLG7L9551e-71G7L955_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA07G05031.19e-55(Glycine max)
STRINGGLYMA07G05061.13e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132271027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-19AGAMOUS-like 62